PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J00664.1.p
Common NameEUGRSUZ_J00664
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NF-YC
Protein Properties Length: 265aa    MW: 28731.3 Da    PI: 4.2626
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J00664.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC37.93.9e-121693098
             NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                      ++adedv +i+  +P l+ska elf+ +l  r++  + +   +tl+   ++++v+  ++fdfl +iv +
  Eucgr.J00664.1.p  1 MQADEDVGKIAMAVPLLVSKALELFLQDLCDRTYDITLKRGAKTLNSLHLKQCVQTFNVFDFLSEIVSK 69
                      899*************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008084.0E-12154IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.108.7E-18168IPR009072Histone-fold
SuperFamilySSF471131.03E-18171IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MQADEDVGKI AMAVPLLVSK ALELFLQDLC DRTYDITLKR GAKTLNSLHL KQCVQTFNVF  60
DFLSEIVSKV PDLGGSDTAG DDRSAAKRRK MVDDGENDTD DESKRSRMND TGHTGSAGRG  120
KGRGRGRGRG RGGRASEGDA TVQNEKFEVD GDVPQQDNLN QDLEGTENGD HLNESKDSIP  180
TPRSAEPPVR NFDLNVDLDE NGDSKSILAS GPTSISAAPD AGFKHEEYPG WSLSEVEKMA  240
IDPIQLANLN RGMDEDDEDY DEEG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A1e-141552175Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122131RGRGRGRGRG
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J00664.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010031686.10.0PREDICTED: dr1-associated corepressor-like
TrEMBLA0A059ABE20.0A0A059ABE2_EUCGR; Uncharacterized protein
STRINGVIT_06s0009g02120.t013e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139682124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.13e-55nuclear factor Y, subunit C11